FUT5 monoclonal antibody (M03), clone 1H6
  • FUT5 monoclonal antibody (M03), clone 1H6

FUT5 monoclonal antibody (M03), clone 1H6

Ref: AB-H00002527-M03
FUT5 monoclonal antibody (M03), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FUT5.
Información adicional
Size 100 ug
Gene Name FUT5
Gene Alias FUC-TV
Gene Description fucosyltransferase 5 (alpha (1,3) fucosyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FUT5 (NP_002025, 95 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2527
Clone Number 1H6
Iso type IgG2b Kappa

Enviar un mensaje


FUT5 monoclonal antibody (M03), clone 1H6

FUT5 monoclonal antibody (M03), clone 1H6