FUT3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FUT3 purified MaxPab rabbit polyclonal antibody (D01P)

FUT3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002525-D01P
FUT3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FUT3 protein.
Información adicional
Size 100 ug
Gene Name FUT3
Gene Alias CD174|FT3B|FucT-III|LE|Les|MGC131739
Gene Description fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FUT3 (NP_000140.1, 1 a.a. ~ 361 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2525

Enviar un mensaje


FUT3 purified MaxPab rabbit polyclonal antibody (D01P)

FUT3 purified MaxPab rabbit polyclonal antibody (D01P)