GAST monoclonal antibody (M03), clone 7G5
  • GAST monoclonal antibody (M03), clone 7G5

GAST monoclonal antibody (M03), clone 7G5

Ref: AB-H00002520-M03
GAST monoclonal antibody (M03), clone 7G5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GAST.
Información adicional
Size 100 ug
Gene Name GAST
Gene Alias GAS
Gene Description gastrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAST (NP_000796.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2520
Clone Number 7G5
Iso type IgG2a Kappa

Enviar un mensaje


GAST monoclonal antibody (M03), clone 7G5

GAST monoclonal antibody (M03), clone 7G5