FUCA1 polyclonal antibody (A01)
  • FUCA1 polyclonal antibody (A01)

FUCA1 polyclonal antibody (A01)

Ref: AB-H00002517-A01
FUCA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FUCA1.
Información adicional
Size 50 uL
Gene Name FUCA1
Gene Alias FUCA
Gene Description fucosidase, alpha-L- 1, tissue
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EAIYASKPWRVQWEKNITSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FUCA1 (NP_000138, 362 a.a. ~ 461 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2517

Enviar un mensaje


FUCA1 polyclonal antibody (A01)

FUCA1 polyclonal antibody (A01)