NR5A2 polyclonal antibody (A01)
  • NR5A2 polyclonal antibody (A01)

NR5A2 polyclonal antibody (A01)

Ref: AB-H00002494-A01
NR5A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NR5A2.
Información adicional
Size 50 uL
Gene Name NR5A2
Gene Alias B1F|B1F2|CPF|FTF|FTZ-F1|FTZ-F1beta|LRH-1|hB1F|hB1F-2
Gene Description nuclear receptor subfamily 5, group A, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq AQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR5A2 (NP_995582, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2494

Enviar un mensaje


NR5A2 polyclonal antibody (A01)

NR5A2 polyclonal antibody (A01)