FSHPRH1 polyclonal antibody (A01)
  • FSHPRH1 polyclonal antibody (A01)

FSHPRH1 polyclonal antibody (A01)

Ref: AB-H00002491-A01
FSHPRH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FSHPRH1.
Información adicional
Size 50 uL
Gene Name CENPI
Gene Alias CENP-I|FSHPRH1|LRPR1|Mis6
Gene Description centromere protein I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KPLLFDHLAQLFFTSTIYFKCSVLQSLKELLQNWLLWLSMDIHMKPVTNSPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FSHPRH1 (NP_006724, 471 a.a. ~ 522 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2491

Enviar un mensaje


FSHPRH1 polyclonal antibody (A01)

FSHPRH1 polyclonal antibody (A01)