FXN MaxPab rabbit polyclonal antibody (D01)
  • FXN MaxPab rabbit polyclonal antibody (D01)

FXN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002395-D01
FXN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FXN protein.
Información adicional
Size 100 uL
Gene Name FXN
Gene Alias CyaY|FA|FARR|FRDA|MGC57199|X25
Gene Description frataxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2395

Enviar un mensaje


FXN MaxPab rabbit polyclonal antibody (D01)

FXN MaxPab rabbit polyclonal antibody (D01)