FXN purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

FXN purified MaxPab mouse polyclonal antibody (B01P)

AB-H00002395-B01P

Producto nuevo

FXN purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name FXN
Gene Alias CyaY|FA|FARR|FRDA|MGC57199|X25
Gene Description frataxin
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2395

Más información

Mouse polyclonal antibody raised against a full-length human FXN protein.

Consulta sobre un producto

FXN purified MaxPab mouse polyclonal antibody (B01P)

FXN purified MaxPab mouse polyclonal antibody (B01P)