FXN polyclonal antibody (A01)
  • FXN polyclonal antibody (A01)

FXN polyclonal antibody (A01)

Ref: AB-H00002395-A01
FXN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FXN.
Información adicional
Size 50 uL
Gene Name FXN
Gene Alias CyaY|FA|FARR|FRDA|MGC57199|X25
Gene Description frataxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2395

Enviar un mensaje


FXN polyclonal antibody (A01)

FXN polyclonal antibody (A01)