FPGS polyclonal antibody (A01)
  • FPGS polyclonal antibody (A01)

FPGS polyclonal antibody (A01)

Ref: AB-H00002356-A01
FPGS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FPGS.
Información adicional
Size 50 uL
Gene Name FPGS
Gene Alias -
Gene Description folylpolyglutamate synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FPGS (NP_004948, 135 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2356

Enviar un mensaje


FPGS polyclonal antibody (A01)

FPGS polyclonal antibody (A01)