FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002348-D01P
FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FOLR1 protein.
Información adicional
Size 100 ug
Gene Name FOLR1
Gene Alias FBP|FOLR|FR-alpha|MOv18
Gene Description folate receptor 1 (adult)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOLR1 (NP_000793.1, 1 a.a. ~ 257 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2348

Enviar un mensaje


FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)

FOLR1 purified MaxPab rabbit polyclonal antibody (D01P)