FLT4 monoclonal antibody (M08), clone 6B7 Ver mas grande

FLT4 monoclonal antibody (M08), clone 6B7

AB-H00002324-M08

Producto nuevo

FLT4 monoclonal antibody (M08), clone 6B7

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name FLT4
Gene Alias FLT41|LMPH1A|PCL|VEGFR3
Gene Description fms-related tyrosine kinase 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2324
Clone Number 6B7
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant FLT4.

Consulta sobre un producto

FLT4 monoclonal antibody (M08), clone 6B7

FLT4 monoclonal antibody (M08), clone 6B7