FLT3LG polyclonal antibody (A01)
  • FLT3LG polyclonal antibody (A01)

FLT3LG polyclonal antibody (A01)

Ref: AB-H00002323-A01
FLT3LG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FLT3LG.
Información adicional
Size 50 uL
Gene Name FLT3LG
Gene Alias FL
Gene Description fms-related tyrosine kinase 3 ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLT3LG (NP_001450, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2323

Enviar un mensaje


FLT3LG polyclonal antibody (A01)

FLT3LG polyclonal antibody (A01)