FLT3 monoclonal antibody (M06), clone 3H1
  • FLT3 monoclonal antibody (M06), clone 3H1

FLT3 monoclonal antibody (M06), clone 3H1

Ref: AB-H00002322-M06
FLT3 monoclonal antibody (M06), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FLT3.
Información adicional
Size 100 ug
Gene Name FLT3
Gene Alias CD135|FLK2|STK1
Gene Description fms-related tyrosine kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLT3 (NP_004110, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2322
Clone Number 3H1
Iso type IgG2a Kappa

Enviar un mensaje


FLT3 monoclonal antibody (M06), clone 3H1

FLT3 monoclonal antibody (M06), clone 3H1