Ver mas grande
FOXO3A polyclonal antibody (A01)
AB-H00002309-A01
Producto nuevo
FOXO3A polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | FOXO3 |
| Gene Alias | AF6q21|DKFZp781A0677|FKHRL1|FKHRL1P2|FOXO2|FOXO3A|MGC12739|MGC31925 |
| Gene Description | forkhead box O3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 2309 |
Más información
Mouse polyclonal antibody raised against a partial recombinant FOXO3A.