FKHL18 purified MaxPab mouse polyclonal antibody (B01P)
  • FKHL18 purified MaxPab mouse polyclonal antibody (B01P)

FKHL18 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002307-B01P
FKHL18 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FKHL18 protein.
Información adicional
Size 50 ug
Gene Name FOXS1
Gene Alias FKHL18|FREAC10|MGC4544
Gene Description forkhead box S1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FKHL18 (NP_004109.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2307

Enviar un mensaje


FKHL18 purified MaxPab mouse polyclonal antibody (B01P)

FKHL18 purified MaxPab mouse polyclonal antibody (B01P)