FOXM1 monoclonal antibody (M09), clone 1D3 Ver mas grande

FOXM1 monoclonal antibody (M09), clone 1D3

AB-H00002305-M09

Producto nuevo

FOXM1 monoclonal antibody (M09), clone 1D3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name FOXM1
Gene Alias FKHL16|FOXM1B|HFH-11|HFH11|HNF-3|INS-1|MPHOSPH2|MPP-2|MPP2|PIG29|TGT3|TRIDENT
Gene Description forkhead box M1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2305
Clone Number 1D3
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a full length recombinant FOXM1.

Consulta sobre un producto

FOXM1 monoclonal antibody (M09), clone 1D3

FOXM1 monoclonal antibody (M09), clone 1D3