Ver mas grande
FOXC2 monoclonal antibody (M11), clone 3D6
AB-H00002303-M11
Producto nuevo
FOXC2 monoclonal antibody (M11), clone 3D6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FOXC2 |
| Gene Alias | FKHL14|LD|MFH-1|MFH1 |
| Gene Description | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2303 |
| Clone Number | 3D6 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant FOXC2.