AB-H00002303-M11
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | FOXC2 |
Gene Alias | FKHL14|LD|MFH-1|MFH1 |
Gene Description | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,S-ELISA,ELISA |
Immunogen Prot. Seq | FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 2303 |
Clone Number | 3D6 |
Iso type | IgG2a Kappa |