Ver mas grande
FOXC2 monoclonal antibody (M02A), clone 2H3
AB-H00002303-M02A
Producto nuevo
FOXC2 monoclonal antibody (M02A), clone 2H3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | FOXC2 |
| Gene Alias | FKHL14|LD|MFH-1|MFH1 |
| Gene Description | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 2303 |
| Clone Number | 2H3 |
| Iso type | IgM Lambda |
Más información
Mouse monoclonal antibody raised against a partial recombinant FOXC2.