FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)
  • FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)

FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002302-B01P
FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FOXJ1 protein.
Información adicional
Size 50 ug
Gene Name FOXJ1
Gene Alias FKHL13|HFH-4|HFH4|MGC35202
Gene Description forkhead box J1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOXJ1 (NP_001445.2, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2302

Enviar un mensaje


FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)

FOXJ1 purified MaxPab mouse polyclonal antibody (B01P)