FKBP5 monoclonal antibody (M02), clone 3D1-1B10
  • FKBP5 monoclonal antibody (M02), clone 3D1-1B10

FKBP5 monoclonal antibody (M02), clone 3D1-1B10

Ref: AB-H00002289-M02
FKBP5 monoclonal antibody (M02), clone 3D1-1B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FKBP5.
Información adicional
Size 100 ug
Gene Name FKBP5
Gene Alias FKBP51|FKBP54|MGC111006|P54|PPIase|Ptg-10
Gene Description FK506 binding protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP5 (AAH42605, 1 a.a. ~ 457 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2289
Clone Number 3D1-1B10
Iso type IgG2b Kappa

Enviar un mensaje


FKBP5 monoclonal antibody (M02), clone 3D1-1B10

FKBP5 monoclonal antibody (M02), clone 3D1-1B10