FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)

FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002287-D01P
FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FKBP3 protein.
Información adicional
Size 100 ug
Gene Name FKBP3
Gene Alias FKBP-25|PPIase
Gene Description FK506 binding protein 3, 25kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FKBP3 (NP_002004.1, 1 a.a. ~ 224 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2287

Enviar un mensaje


FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)

FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)