FKBP1B polyclonal antibody (A01)
  • FKBP1B polyclonal antibody (A01)

FKBP1B polyclonal antibody (A01)

Ref: AB-H00002281-A01
FKBP1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FKBP1B.
Información adicional
Size 50 uL
Gene Name FKBP1B
Gene Alias FKBP12.6|FKBP1L|OTK4|PKBP1L|PPIase
Gene Description FK506 binding protein 1B, 12.6 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP1B (AAH02614, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2281

Enviar un mensaje


FKBP1B polyclonal antibody (A01)

FKBP1B polyclonal antibody (A01)