FHL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FHL2 purified MaxPab rabbit polyclonal antibody (D01P)

FHL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002274-D01P
FHL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FHL2 protein.
Información adicional
Size 100 ug
Gene Name FHL2
Gene Alias AAG11|DRAL|SLIM3
Gene Description four and a half LIM domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FHL2 (NP_963849.1, 1 a.a. ~ 279 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2274

Enviar un mensaje


FHL2 purified MaxPab rabbit polyclonal antibody (D01P)

FHL2 purified MaxPab rabbit polyclonal antibody (D01P)