FHIT monoclonal antibody (M01), clone 1C3
  • FHIT monoclonal antibody (M01), clone 1C3

FHIT monoclonal antibody (M01), clone 1C3

Ref: AB-H00002272-M01
FHIT monoclonal antibody (M01), clone 1C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FHIT.
Información adicional
Size 100 ug
Gene Name FHIT
Gene Alias AP3Aase|FRA3B
Gene Description fragile histidine triad gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FHIT (AAH32336, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2272
Clone Number 1C3
Iso type IgG1 kappa

Enviar un mensaje


FHIT monoclonal antibody (M01), clone 1C3

FHIT monoclonal antibody (M01), clone 1C3