FGFR4 monoclonal antibody (M05), clone 1E2
  • FGFR4 monoclonal antibody (M05), clone 1E2

FGFR4 monoclonal antibody (M05), clone 1E2

Ref: AB-H00002264-M05
FGFR4 monoclonal antibody (M05), clone 1E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FGFR4.
Información adicional
Size 100 ug
Gene Name FGFR4
Gene Alias CD334|JTK2|MGC20292|TKF
Gene Description fibroblast growth factor receptor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq EPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGFR4 (AAH11847.1, 31 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2264
Clone Number 1E2
Iso type IgG2a Kappa

Enviar un mensaje


FGFR4 monoclonal antibody (M05), clone 1E2

FGFR4 monoclonal antibody (M05), clone 1E2