FGFR2 monoclonal antibody (M04), clone 3F4
  • FGFR2 monoclonal antibody (M04), clone 3F4

FGFR2 monoclonal antibody (M04), clone 3F4

Ref: AB-H00002263-M04
FGFR2 monoclonal antibody (M04), clone 3F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FGFR2.
Información adicional
Size 100 ug
Gene Name FGFR2
Gene Alias BEK|BFR-1|CD332|CEK3|CFD1|ECT1|FLJ98662|JWS|K-SAM|KGFR|TK14|TK25
Gene Description fibroblast growth factor receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2263
Clone Number 3F4
Iso type IgG2b Kappa

Enviar un mensaje


FGFR2 monoclonal antibody (M04), clone 3F4

FGFR2 monoclonal antibody (M04), clone 3F4