FGFR2 polyclonal antibody (A01)
  • FGFR2 polyclonal antibody (A01)

FGFR2 polyclonal antibody (A01)

Ref: AB-H00002263-A01
FGFR2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FGFR2.
Información adicional
Size 50 uL
Gene Name FGFR2
Gene Alias BEK|BFR-1|CD332|CEK3|CFD1|ECT1|FLJ98662|JWS|K-SAM|KGFR|TK14|TK25
Gene Description fibroblast growth factor receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2263

Enviar un mensaje


FGFR2 polyclonal antibody (A01)

FGFR2 polyclonal antibody (A01)