FGF12 monoclonal antibody (M10), clone 1D9
  • FGF12 monoclonal antibody (M10), clone 1D9

FGF12 monoclonal antibody (M10), clone 1D9

Ref: AB-H00002257-M10
FGF12 monoclonal antibody (M10), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FGF12.
Información adicional
Size 100 ug
Gene Name FGF12
Gene Alias FGF12B|FHF1
Gene Description fibroblast growth factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF12 (AAH22524, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2257
Clone Number 1D9
Iso type IgG1 Kappa

Enviar un mensaje


FGF12 monoclonal antibody (M10), clone 1D9

FGF12 monoclonal antibody (M10), clone 1D9