FGF12 purified MaxPab rabbit polyclonal antibody (D01P)
  • FGF12 purified MaxPab rabbit polyclonal antibody (D01P)

FGF12 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002257-D01P
FGF12 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FGF12 protein.
Información adicional
Size 100 ug
Gene Name FGF12
Gene Alias FGF12B|FHF1
Gene Description fibroblast growth factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FGF12 (NP_066360.1, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2257

Enviar un mensaje


FGF12 purified MaxPab rabbit polyclonal antibody (D01P)

FGF12 purified MaxPab rabbit polyclonal antibody (D01P)