FGF10 polyclonal antibody (A01)
  • FGF10 polyclonal antibody (A01)

FGF10 polyclonal antibody (A01)

Ref: AB-H00002255-A01
FGF10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FGF10.
Información adicional
Size 50 uL
Gene Name FGF10
Gene Alias -
Gene Description fibroblast growth factor 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF10 (NP_004456, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2255

Enviar un mensaje


FGF10 polyclonal antibody (A01)

FGF10 polyclonal antibody (A01)