FGF5 purified MaxPab rabbit polyclonal antibody (D01P)
  • FGF5 purified MaxPab rabbit polyclonal antibody (D01P)

FGF5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002250-D01P
FGF5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FGF5 protein.
Información adicional
Size 100 ug
Gene Name FGF5
Gene Alias HBGF-5|Smag-82
Gene Description fibroblast growth factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FGF5 (NP_149134.1, 1 a.a. ~ 123 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2250

Enviar un mensaje


FGF5 purified MaxPab rabbit polyclonal antibody (D01P)

FGF5 purified MaxPab rabbit polyclonal antibody (D01P)