FCN2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002220-D01P
FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FCN2 protein.
Información adicional
Size 100 ug
Gene Name FCN2
Gene Alias EBP-37|FCNL|P35|ficolin-2
Gene Description ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FCN2 (NP_004099.2, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2220

Enviar un mensaje


FCN2 purified MaxPab rabbit polyclonal antibody (D01P)

FCN2 purified MaxPab rabbit polyclonal antibody (D01P)