FCN1 MaxPab rabbit polyclonal antibody (D01)
  • FCN1 MaxPab rabbit polyclonal antibody (D01)

FCN1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002219-D01
FCN1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FCN1 protein.
Información adicional
Size 100 uL
Gene Name FCN1
Gene Alias FCNM
Gene Description ficolin (collagen/fibrinogen domain containing) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FCN1 (NP_001994.2, 1 a.a. ~ 326 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2219

Enviar un mensaje


FCN1 MaxPab rabbit polyclonal antibody (D01)

FCN1 MaxPab rabbit polyclonal antibody (D01)