FCN1 purified MaxPab mouse polyclonal antibody (B01P)
  • FCN1 purified MaxPab mouse polyclonal antibody (B01P)

FCN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002219-B01P
FCN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FCN1 protein.
Información adicional
Size 50 ug
Gene Name FCN1
Gene Alias FCNM
Gene Description ficolin (collagen/fibrinogen domain containing) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FCN1 (NP_001994.2, 1 a.a. ~ 326 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2219

Enviar un mensaje


FCN1 purified MaxPab mouse polyclonal antibody (B01P)

FCN1 purified MaxPab mouse polyclonal antibody (B01P)