FCER2 monoclonal antibody (M03), clone S52
  • FCER2 monoclonal antibody (M03), clone S52

FCER2 monoclonal antibody (M03), clone S52

Ref: AB-H00002208-M03
FCER2 monoclonal antibody (M03), clone S52

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FCER2.
Información adicional
Size 100 ug
Gene Name FCER2
Gene Alias CD23|CD23A|CLEC4J|FCE2|IGEBF
Gene Description Fc fragment of IgE, low affinity II, receptor for (CD23)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FCER2 (AAH14108, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2208
Clone Number S52
Iso type IgG1 Kappa

Enviar un mensaje


FCER2 monoclonal antibody (M03), clone S52

FCER2 monoclonal antibody (M03), clone S52