FAU purified MaxPab rabbit polyclonal antibody (D01P)
  • FAU purified MaxPab rabbit polyclonal antibody (D01P)

FAU purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002197-D01P
FAU purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FAU protein.
Información adicional
Size 100 ug
Gene Name FAU
Gene Alias FAU1|FLJ22986|Fub1|Fubi|MNSFbeta|RPS30
Gene Description Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAU (NP_001988.1, 1 a.a. ~ 133 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2197

Enviar un mensaje


FAU purified MaxPab rabbit polyclonal antibody (D01P)

FAU purified MaxPab rabbit polyclonal antibody (D01P)