FAU polyclonal antibody (A01)
  • FAU polyclonal antibody (A01)

FAU polyclonal antibody (A01)

Ref: AB-H00002197-A01
FAU polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FAU.
Información adicional
Size 50 uL
Gene Name FAU
Gene Alias FAU1|FLJ22986|Fub1|Fubi|MNSFbeta|RPS30
Gene Description Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAU (NP_001988, 35 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2197

Enviar un mensaje


FAU polyclonal antibody (A01)

FAU polyclonal antibody (A01)