FANCG MaxPab rabbit polyclonal antibody (D01)
  • FANCG MaxPab rabbit polyclonal antibody (D01)

FANCG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002189-D01
FANCG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FANCG protein.
Información adicional
Size 100 uL
Gene Name FANCG
Gene Alias FAG|XRCC9
Gene Description Fanconi anemia, complementation group G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCG (NP_004620.1, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2189

Enviar un mensaje


FANCG MaxPab rabbit polyclonal antibody (D01)

FANCG MaxPab rabbit polyclonal antibody (D01)