FANCF purified MaxPab mouse polyclonal antibody (B01P)
  • FANCF purified MaxPab mouse polyclonal antibody (B01P)

FANCF purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002188-B01P
FANCF purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FANCF protein.
Información adicional
Size 50 ug
Gene Name FANCF
Gene Alias FAF|MGC126856
Gene Description Fanconi anemia, complementation group F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCF (NP_073562.1, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2188

Enviar un mensaje


FANCF purified MaxPab mouse polyclonal antibody (B01P)

FANCF purified MaxPab mouse polyclonal antibody (B01P)