ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)

ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002181-D01P
ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACSL3 protein.
Información adicional
Size 100 ug
Gene Name ACSL3
Gene Alias ACS3|FACL3|PRO2194
Gene Description acyl-CoA synthetase long-chain family member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACSL3 (NP_004448.2, 1 a.a. ~ 720 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2181

Enviar un mensaje


ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)

ACSL3 purified MaxPab rabbit polyclonal antibody (D01P)