Ver mas grande
ACSL3 MaxPab rabbit polyclonal antibody (D01)
AB-H00002181-D01
Producto nuevo
ACSL3 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | ACSL3 |
| Gene Alias | ACS3|FACL3|PRO2194 |
| Gene Description | acyl-CoA synthetase long-chain family member 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHT |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | ACSL3 (NP_004448.2, 1 a.a. ~ 720 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 2181 |
Más información
Rabbit polyclonal antibody raised against a full-length human ACSL3 protein.