ACSL1 monoclonal antibody (M02), clone 3G4
  • ACSL1 monoclonal antibody (M02), clone 3G4

ACSL1 monoclonal antibody (M02), clone 3G4

Ref: AB-H00002180-M02
ACSL1 monoclonal antibody (M02), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACSL1.
Información adicional
Size 100 ug
Gene Name ACSL1
Gene Alias ACS1|FACL1|FACL2|LACS|LACS1|LACS2
Gene Description acyl-CoA synthetase long-chain family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACSL1 (NP_001986, 48 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2180
Clone Number 3G4
Iso type IgG2a Kappa

Enviar un mensaje


ACSL1 monoclonal antibody (M02), clone 3G4

ACSL1 monoclonal antibody (M02), clone 3G4