FANCE purified MaxPab mouse polyclonal antibody (B01P)
  • FANCE purified MaxPab mouse polyclonal antibody (B01P)

FANCE purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002178-B01P
FANCE purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FANCE protein.
Información adicional
Size 50 ug
Gene Name FANCE
Gene Alias FACE|FAE
Gene Description Fanconi anemia, complementation group E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATPDAGLPGAEGVEPAPWAQLEAPARLLLQALQAGPEGARRGLGVLRALGSRGWEPFDWGRLLEALCREEPVVQGPDGRLELKPLLLRLPRICQRNLMSLLMAVRPSLPESGLLSVLQIAQQDLAPDPDAWLRALGELLRRDLGVGTSMEGASPLSERCQRQLQSLCRGLGLGGRRLKSPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDHEKERPEHKSLESLADGGSASPIKDQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCE (NP_068741.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2178

Enviar un mensaje


FANCE purified MaxPab mouse polyclonal antibody (B01P)

FANCE purified MaxPab mouse polyclonal antibody (B01P)