FABP2 monoclonal antibody (M11), clone 2F7
  • FABP2 monoclonal antibody (M11), clone 2F7

FABP2 monoclonal antibody (M11), clone 2F7

Ref: AB-H00002169-M11
FABP2 monoclonal antibody (M11), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FABP2.
Información adicional
Size 100 ug
Gene Name FABP2
Gene Alias FABPI|I-FABP|MGC133132
Gene Description fatty acid binding protein 2, intestinal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FABP2 (NP_000125.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2169
Clone Number 2F7
Iso type IgG1 Kappa

Enviar un mensaje


FABP2 monoclonal antibody (M11), clone 2F7

FABP2 monoclonal antibody (M11), clone 2F7