F13A1 MaxPab rabbit polyclonal antibody (D01)
  • F13A1 MaxPab rabbit polyclonal antibody (D01)

F13A1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002162-D01
F13A1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human F13A1 protein.
Información adicional
Size 100 uL
Gene Name F13A1
Gene Alias F13A
Gene Description coagulation factor XIII, A1 polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen F13A1 (AAH27963.1, 1 a.a. ~ 732 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2162

Enviar un mensaje


F13A1 MaxPab rabbit polyclonal antibody (D01)

F13A1 MaxPab rabbit polyclonal antibody (D01)