F12 monoclonal antibody (M01), clone 3A3
  • F12 monoclonal antibody (M01), clone 3A3

F12 monoclonal antibody (M01), clone 3A3

Ref: AB-H00002161-M01
F12 monoclonal antibody (M01), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant F12.
Información adicional
Size 100 ug
Gene Name F12
Gene Alias HAE3|HAEX|HAF
Gene Description coagulation factor XII (Hageman factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq GHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen F12 (AAH12390, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2161
Clone Number 3A3
Iso type IgG2a Kappa

Enviar un mensaje


F12 monoclonal antibody (M01), clone 3A3

F12 monoclonal antibody (M01), clone 3A3