F2R MaxPab rabbit polyclonal antibody (D01)
  • F2R MaxPab rabbit polyclonal antibody (D01)

F2R MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002149-D01
F2R MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human F2R protein.
Información adicional
Size 100 uL
Gene Name F2R
Gene Alias CF2R|HTR|PAR1|TR
Gene Description coagulation factor II (thrombin) receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen F2R (AAH02464.1, 1 a.a. ~ 425 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2149

Enviar un mensaje


F2R MaxPab rabbit polyclonal antibody (D01)

F2R MaxPab rabbit polyclonal antibody (D01)