EZH2 monoclonal antibody (M01), clone 2C3
  • EZH2 monoclonal antibody (M01), clone 2C3

EZH2 monoclonal antibody (M01), clone 2C3

Ref: AB-H00002146-M01
EZH2 monoclonal antibody (M01), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EZH2.
Información adicional
Size 100 ug
Gene Name EZH2
Gene Alias ENX-1|EZH1|KMT6|MGC9169
Gene Description enhancer of zeste homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EZH2 (AAH10858, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2146
Clone Number 2C3
Iso type IgG2b Kappa

Enviar un mensaje


EZH2 monoclonal antibody (M01), clone 2C3

EZH2 monoclonal antibody (M01), clone 2C3