EZH2 purified MaxPab rabbit polyclonal antibody (D02P)
  • EZH2 purified MaxPab rabbit polyclonal antibody (D02P)

EZH2 purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00002146-D02P
EZH2 purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EZH2 protein.
Información adicional
Size 100 ug
Gene Name EZH2
Gene Alias ENX-1|EZH1|KMT6|MGC9169
Gene Description enhancer of zeste homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EZH2 (NP_004447.2, 1 a.a. ~ 751 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2146

Enviar un mensaje


EZH2 purified MaxPab rabbit polyclonal antibody (D02P)

EZH2 purified MaxPab rabbit polyclonal antibody (D02P)